Active Recombinant Mouse Il11 Protein

• Cat.No.: Il11-182I
• Product Overview: Recombinant Mouse Il11 Protein without tag was expressed in HEK 293.

Specification

• Species: Mouse
• Source: HEK293
• Description: Interleukin-11 (IL-11) is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 contains no cysteine residues or potential glycosylation sites. IL-11 has multiple effects on both hematopoietic and nonhematopoietic cells. Many of the biological effects described for IL-11 overlap those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell dependent development of specific immunoglobulin-secreting B cell.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 3 ng/mL, measured in a cell proliferation assay using T11 cells.
• Molecular Mass: ~21 kDa, observed by reducing SDS-PAGE.
• AA Sequence: GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Murine Interleukin-11 (IL-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Interleukin-11 (IL-11) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il11 interleukin 11 [ Mus musculus ]
• Official Symbol: Il11
• Synonyms: IL11; interleukin 11; interleukin-11; IL-11
• Gene ID: 16156
• mRNA Refseq: NM_008350
• Protein Refseq: NP_032376
• UniProt ID: P47873