Active Recombinant Human IL11 Protein

• Cat.No.: IL11-130H
• Product Overview: Recombinant Human IL11 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: Interleukin 11 (IL-11) is a member of the gp130 family of cytokines. IL-11 functions to promote hematopoietic stem cell proliferation and megakaryocyte differentiation. In non-hematopoietic cell populations, IL-11 stimulates acute-phase proteins, modulates the development of immunoglobulin-producing B cells, and regulates bone turnover. IL-11 binds the IL-11Rα receptor to activate JAK downstream signaling. Human IL-11 shows activity on murine cells.
• Bio-activity: TF-1 cell proliferation, ≤10 ng/mL; ≥1.0 x 10^5 units/mg
• Molecular Mass: Monomer, 19.3 kDa (179 aa)
• AA Sequence: MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: IL11 interleukin 11 [ Homo sapiens (human) ]
• Official Symbol: IL11
• Synonyms: IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11
• Gene ID: 3589
• mRNA Refseq: NM_000641
• Protein Refseq: NP_000632
• MIM: 147681
• UniProt ID: P20809