Recombinant Rat Il11 protein, His-PDI-tagged

• Cat.No.: Il11-4212R
• Product Overview: Recombinant Rat Il11 protein(Q99MF5)(22-199aa), fused with N-terminal His and PDI tag, was expressed in Yeast.

Specification

• Species: Rat
• Source: Yeast
• Tag: N-His-PDI
• ProteinLength: 22-199aa
• Tag: N-His-PDI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 78.0 kDa
• AASequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Il11 interleukin 11 [ Rattus norvegicus ]
• Official Symbol: Il11
• Synonyms: IL11; interleukin 11; interleukin-11; Il-11
• Gene ID: 171040
• mRNA Refseq: NM_133519
• Protein Refseq: NP_598203