Active Recombinant Human IGF2 Protein (68 aa)

• Cat.No.: IGF2-373I
• Product Overview: Recombinant human Insulin-like Growth Factor II (rhIGF-II) produced in E. coli is a single non-glycosylated polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhIGF-II has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 68
• Description: Insulin-like Growth Factor II (IGF-II) is a single chain 7 kDa polypeptide, and shares a high degree of homology with insulin. During circulation in vivo, IGF-II is complexed to high affinity binding proteins, IGF Binding Proteins (IGFBP), which act as circulating reservoirs, transport IGF-II, and prolong the half life of IGF-II. The receptors of IGF-II (IGFRs) are transmembrane tyrosine receptors, and are heterotetrameric consisting of two α-subunits and two β-subunits. IGFRs execute their role via intracellullar signaling molecules, such as IRS, shc, and PI3K. The functions of IGF-II include promoting cell survival, growth, proliferation, differentiation and motility. In particular, IGF-II promotes proliferation, inhibits death, and stimulates transformation in breast cancer cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 20 ng/mL, measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 5 × 10^4 units/mg.
• Molecular Mass: 7.6 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Insulin-like Growth Factor II (rhIGF-II) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIGF-II remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 25mM Tris, pH8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
• Official Symbol: IGF2
• Synonyms: IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066
• Gene ID: 3481
• mRNA Refseq: NM_000612
• Protein Refseq: NP_000603
• MIM: 147470
• UniProt ID: P01344