Recombinant Active Mouse IFNL2 Protein, His-tagged(C-ter)

• Cat.No.: Ifnl2-122M
• Product Overview: Recombinant Active Mouse IFNL2 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28B (IL28B), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 2 ng/mL.
• AA Sequence: MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Ifnl2 interferon lambda 2 [ Mus musculus (house mouse) ]
• Official Symbol: Ifnl2
• Synonyms: IFNL2; interferon lambda 2; IL28A; IFNL2a; IFNL3a; IL-28A; interferon lambda-2; IFN-lambda-2; cytokine Zcyto20; interleukin 28A (interferon, lambda 2); interleukin-28A
• Gene ID: 330496
• mRNA Refseq: NM_001024673
• Protein Refseq: NP_001019844
• UniProt ID: Q4VK74