Active Recombinant Human IFNL1 Protein

• Cat.No.: IFNL1-17H
• Product Overview: Recombinant Human IFNL1 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: 178 amino acids
• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 is determined in an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is typically 1-5 ng/mL, corresponding to a Specific Activity of ＞2 × 10^5 IU/mg.
• Molecular Mass: 19.8 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids.
• AA Sequence: PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
• Endotoxin: Less than 1 EU/μg of rHuIFN-λ1 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IFNL1 interferon lambda 1 [ Homo sapiens (human) ]
• Official Symbol: IFNL1
• Synonyms: IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1
  IFN-lambda-1
  cytokine Zcyto21
  interleukin 29 (interferon, lambda 1)
  interleukin-29
• Gene ID: 282618
• mRNA Refseq: NM_172140
• Protein Refseq: NP_742152
• MIM: 607403
• UniProt ID: Q8IU54