Active Recombinant Human IFNG Protein (144 aa)

• Cat.No.: IFNG-105I
• Product Overview: Recombinant Human IFNG Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 144
• Description: Interferon-gamma (IFN-γ, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. Human IFN-γ is highly species specific and is biologically active only in human and primate cells. IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-γ also augments TH1 cell expansion and may be required for TH1 cell differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The specific activity as determined in a viral resistance assay is less then 0.05 ng/mL, corresponding to a specific activity of 2.0 × 10^7 IU/mg.
• Molecular Mass: Approximately 17 kDa, a single non-glycosylated polypeptide chain containing 144 amino acids.
• AA Sequence: MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
• Endotoxin: Less than 1 EU/μg of rHuIFN-γ as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IFNG interferon, gamma [ Homo sapiens ]
• Official Symbol: IFNG
• Synonyms: IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI
• Gene ID: 3458
• mRNA Refseq: NM_000619
• Protein Refseq: NP_000610
• MIM: 147570
• UniProt ID: P01579