Active Recombinant Human IFNB1 Protein
Cat.No. : | IFNB1-186I |
Product Overview : | Recombinant Human IFNB1 Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 ng/mL, measured in a proliferation assay using TF-1 Cells. |
Molecular Mass : | ~23 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ] |
Official Symbol | IFNB1 |
Synonyms | IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956; |
Gene ID | 3456 |
mRNA Refseq | NM_002176 |
Protein Refseq | NP_002167 |
MIM | 147640 |
UniProt ID | P01574 |
◆ Recombinant Proteins | ||
IFNB1-082H | Active Recombinant Human IFNB1 Protein | +Inquiry |
Ifnb1-524R | Recombinant Rat Ifnb1 | +Inquiry |
Ifnb1-108M | Recombinant Mouse Interferon Beta 1, Fibroblast, His-tagged | +Inquiry |
IFNB1-2996R | Recombinant Rat IFNB1 Protein | +Inquiry |
IFNB1-2024R | Active Recombinant Rhesus IFNB1 protein, mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *
0
Inquiry Basket