Active Recombinant Human IFNB1 Protein

Description :	Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.
Source :	HEK 293
Species :	Human
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 0.1 ng/mL, measured in a proliferation assay using TF-1 Cells.
Molecular Mass :	~23 kDa, observed by reducing SDS-PAGE.
AA Sequence :	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ]
Official Symbol	IFNB1
Synonyms	IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956;
Gene ID	3456
mRNA Refseq	NM_002176
Protein Refseq	NP_002167
MIM	147640
UniProt ID	P01574