Active Recombinant Human HTRA4 protein, His-tagged

Cat.No. : HTRA4-790H
Product Overview : Recombinant human HTRA4 protein fragment (138 to 476 aa) was expressed in E. coli with C-terminus his tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 138-476 a.a.
Description : This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.
Form : 0.64% Tris HCl, 15% Glycerol, 0.704% Sodium chloride, 0.816% Imidazole, pH 7.5.
Bio-activity : Proteolytic activity of this product was documented by digestion of ß- casein. 0.5 mg ß-casein/ml are completely digested by 10 µg/ml HTRA4 within 24 hours at 37 centigrade.
Molecular Mass : 38 kDa
AA Sequence : MRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQRGGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGISFAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKALDSDSLSMAVLRGKDNLLLTVIPETINHHHHHH
Purity : >90% by SDS-PAGE
Storage : Store at -80 centigrade. Avoid freeze-thaw cycles.
Concentration : 0.1 mg/mL
Gene Name HtrA serine peptidase 4 [ Homo sapiens ]
Official Symbol HTRA4
Synonyms HTRA4; HtrA serine peptidase 4; probable serine protease HTRA4; FLJ90724
Gene ID 203100
mRNA Refseq NM_153692
Protein Refseq NP_710159
MIM 610700
UniProt ID P83105

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HTRA4 Products

Required fields are marked with *

My Review for All HTRA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon