Active Recombinant Human HBEGF Protein
Cat.No. : | HBEGF-112H |
Product Overview : | Recombinant Human HBEGF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Heparin-binding EGF-like growth factor (HB-EGF) is a member of the epidermal growth factor (EGF) family and is expressed by monocytes and macrophages. HB-EGF is the predominant growth factor involved in epithelialization during wound healing. HB-EGF signals through the receptor tyrosine kinase ErbB2 to maintain adult heart homeostasis, and promotes cardiac valve development through binding in high affinity to the epidermal growth factor receptor (EGFR). HB-EGF binds the the ErbB4 receptor tyrosine kinase to mediate implantation of the human blastocyst. HB-EGF also functions as a potent mitogen for fibroblasts and smooth muscle cells. |
Bio-activity : | 3T3 cell proliferation, ≤1 ng/mL; ≥1.0 x 10^6 units/mg |
Molecular Mass : | Monomer, 9.9 kDa (87 aa) |
AA Sequence : | MDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | HBEGF heparin-binding EGF-like growth factor [ Homo sapiens (human) ] |
Official Symbol | HBEGF |
Synonyms | HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL; |
Gene ID | 1839 |
mRNA Refseq | NM_001945 |
Protein Refseq | NP_001936 |
MIM | 126150 |
UniProt ID | Q99075 |
◆ Recombinant Proteins | ||
HBEGF-4076M | Recombinant Mouse HBEGF Protein, His (Fc)-Avi-tagged | +Inquiry |
HBEGF-13682H | Recombinant Human HBEGF, GST-tagged | +Inquiry |
HBEGF-1534H | Active Recombinant Human HBEGF protein, His-tagged | +Inquiry |
Hbegf-592R | Recombinant Rat Hbegf protein | +Inquiry |
HBEGF-112H | Active Recombinant Human HBEGF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBEGF Products
Required fields are marked with *
My Review for All HBEGF Products
Required fields are marked with *
0
Inquiry Basket