Active Recombinant Human FLT3LG Protein
Cat.No. : | FLT3LG-100H |
Product Overview : | Recombinant Human FLT3LG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3). Human FLT-3 ligand is active on mouse cells. |
Bio-activity : | OCI-AML5 cell proliferation, ≤10 ng/mL; ≥1.0 x 10^5 units/mg |
Molecular Mass : | Monomer, 17.7 kDa (155 aa) |
AA Sequence : | MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM NaCl, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens (human) ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-100H | Active Recombinant Human FLT3LG Protein | +Inquiry |
FLT3LG-4375H | Recombinant Human FLT3LG Protein, GST-tagged | +Inquiry |
FLT3LG-1235H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-1235R | Active Recombinant Rhesus monkey FLT3LG Protein | +Inquiry |
Flt3l-97M | Recombinant Mouse FLT3LG Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket