Active Recombinant Human FGF4 Protein

• Cat.No.: FGF4-4113H
• Product Overview: Human FGF4 (P08620) recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq
• Form: Lyophilized
• Bio-activity: The activity is determined by the ability to induce the proliferation of mouse NR6R-3T3 fibroblasts. The expected ED50 for this effect is less than 0.1 ng/mL.
• Molecular Mass: 19 kDa
• AA Sequence: MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
• Endotoxin: < 0.1 EU/μg
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade or lower. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from 0.5X PBS, pH 7.5

Gene Information

• Gene Name: FGF4 fibroblast growth factor 4 [ Homo sapiens ]
• Official Symbol: FGF4
• Synonyms: FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1, HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4
• Gene ID: 2249
• mRNA Refseq: NM_002007
• Protein Refseq: NP_001998
• MIM: 164980
• UniProt ID: P08620