Active Recombinant Human FGF4 Protein (177 aa)

• Cat.No.: FGF4-413F
• Product Overview: Recombinant human Fibroblast Growth Factor-4 (rhFGF-4) produced in E. coli is a single non-glycosylated polypeptide chain containing 177 amino acids. A fully biologically active molecule obtained by proprietary chromatographic techniques, rhFGF-4 has a molecular mass of 19.4kDa as analyzed by reducing SDS-PAGE.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 177
• Description: Fibroblast Growth Factor-4 (FGF-4) also known as K-FGF is a heparin-binding growth factor of the FGF family.It was identified by its oncogenic transforming activity. FGF-4 and FGF-3 are located closely on chromosome 11. FGF-4 and its receptors (FGF R1c, 2c, 3c and 4) play an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. FGF-4 is required for normal limb and cardiac valve development during embryogenesis.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.5 ng/mL, measured in a cell proliferation assay using 3T3 cells, corresponding to a specific activity of >2.0 × 10^6 units/mg.
• Molecular Mass: 19.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Fibroblast Growth Factor-4 (rhFGF-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-4 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM HEPES, 750mM NaCl, pH7.5.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: FGF4 fibroblast growth factor 4 [ Homo sapiens ]
• Official Symbol: FGF4
• Synonyms: FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1, HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4
• Gene ID: 2249
• mRNA Refseq: NM_002007
• Protein Refseq: NP_001998
• MIM: 164980
• UniProt ID: P08620