Active Recombinant Human FGF4 Protein (177 aa)

Cat.No. : FGF4-413F
Product Overview : Recombinant human Fibroblast Growth Factor-4 (rhFGF-4) produced in E. coli is a single non-glycosylated polypeptide chain containing 177 amino acids. A fully biologically active molecule obtained by proprietary chromatographic techniques, rhFGF-4 has a molecular mass of 19.4kDa as analyzed by reducing SDS-PAGE.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 177
Description : Fibroblast Growth Factor-4 (FGF-4) also known as K-FGF is a heparin-binding growth factor of the FGF family.It was identified by its oncogenic transforming activity. FGF-4 and FGF-3 are located closely on chromosome 11. FGF-4 and its receptors (FGF R1c, 2c, 3c and 4) play an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. FGF-4 is required for normal limb and cardiac valve development during embryogenesis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.5 ng/mL, measured in a cell proliferation assay using 3T3 cells, corresponding to a specific activity of >2.0 × 10^6 units/mg.
Molecular Mass : 19.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Fibroblast Growth Factor-4 (rhFGF-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-4 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM HEPES, 750mM NaCl, pH7.5.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name FGF4 fibroblast growth factor 4 [ Homo sapiens ]
Official Symbol FGF4
Synonyms FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1, HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4;
Gene ID 2249
mRNA Refseq NM_002007
Protein Refseq NP_001998
MIM 164980
UniProt ID P08620

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF4 Products

Required fields are marked with *

My Review for All FGF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon