Active Recombinant Human FGF10 Protein (187 aa), N-His-tagged

• Cat.No.: FGF10-422F
• Product Overview: Recombinant human Fibroblast Growth Factor-10 (rhFGF-10) with N-terminal His-tag produced in E. coli is a single non-glycosylated polypeptide chain containing 187 amino acids. A fully biologically active molecule, rhFGF-10 has a molecular mass of 21.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Description: Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares the homolog and receptor FGFR2-IIIb with KGF. However, unlike KGF which induces the proliferation and differentiation of various epithelial cells, FGF-10 is an essential factor for the budding and branching morphogenesis during the multi-organ development via the instructive mesenchymal-epithelial interactions. FGF-10 is crucial for lung and limb development, and is regulated by Shh during early development.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 20 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^4 units/mg.
• Molecular Mass: 21.4 kDa, observed by reducing SDS-PAGE.
• Protein length: 187
• AA Sequence: MNHKVHHHHHHMDDDDKMLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Fibroblast Growth Factor-10 (rhFGF-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: FGF10 fibroblast growth factor 10 [ Homo sapiens ]
• Official Symbol: FGF10
• Synonyms: FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria
• Gene ID: 2255
• mRNA Refseq: NM_004465
• Protein Refseq: NP_004456
• MIM: 602115
• UniProt ID: O15520