Recombinant Chicken FGF10 Protein, His tagged

Description :	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing.
Source :	E. coli
Species :	Chicken
Tag :	His
Molecular Mass :	The protein has a calculated MW of 22 kDa.
AA Sequence :	MGSSHHHHHHSSGLVPRGSHMHDLGQDMLSPEATNSSSSSSSSFPSSFSSPSSAGRHVRSYNHLQGDVRKRKLYSYNKYFLKIEKNGKVSGTKKENCPFSILEITSVEIGVVAVKSIKSNYYLAMNKKGKVYGSKEFNSDCKLKERIEENGYNTYASLNWKHNGRQMFVALNGRGATKRGQKTRRKNTSAHFLPMVVMS
Endotoxin :	< 1 EU/μg by LAL
Purity :	> 95% by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration :	0.85 mg/mL by BCA
Storage Buffer :	Sterile 50 mM Tris, 500 mM NaCl, pH 8.0

Gene Name	FGF10 fibroblast growth factor 10 [ Gallus gallus (chicken) ]
Official Symbol	FGF10
Synonyms	FGF10; fibroblast growth factor 10
Gene ID	395432
mRNA Refseq	NM_204696
Protein Refseq	NP_990027
UniProt ID	O42407