Active Recombinant Human FGF10 Protein (170 aa, 40-208)

• Cat.No.: FGF10-088F
• Product Overview: Recombinant Human FGF10 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 170, 40-208
• Description: KGF-2(also known as FGF-10) was originally identified from rat embryos by homology-based polymerase chain reaction. Human and mouse KGF-2 were subsequently cloned. The human KGF-2 cDNA encodes a 208 amino acid residue protein with a hydrophobic amino-terminal signal peptide. Human KGF-2 shares approximately 92% and 95% amino acid sequence identity with mouse and rat KGF-2, respectively. Among the FGF family members, KGF-2 is most closely related to FGF-7. The expression of KGF-2 transcripts has been shown to be most abundant in the embryo and adult lung. Recombinant KGF-2 preparations have been shown to be mitogenic for epithelial and epidermal cells but not fibroblasts. Based on its in vitro biological activities and in vivo expression pattern, KGF-2 has been proposed to play unique roles in the brain, in lung development, wound healing and limb bud formation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors yielding an ED50 < 0.5 ng/mL., corresponding to a specific activity of 2.0 × 10^6 Units/mg.
• Molecular Mass: Approximately 19.3 kDa, 170 amino acid residues consisting of Methionine and the mature human KGF-2 (amino acid residues 40-208).
• AA Sequence: MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
• Endotoxin: Less than 1 EU/mg of rHuKGF-2 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FGF10 fibroblast growth factor 10 [ Homo sapiens (human) ]
• Official Symbol: FGF10
• Synonyms: FGF10; fibroblast growth factor 10; LADD3; ; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria
• Gene ID: 2255
• mRNA Refseq: NM_004465
• Protein Refseq: NP_004456
• MIM: 602115
• UniProt ID: O15520