Active Recombinant Human FGF-10 Protein
Cat.No. : | FGF10-81H |
Product Overview : | Recombinant Human FGF-10 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fibroblast growth factor 10 (FGF-10) is a growth factor that is important during embryonic development, especially during lung, limb, brain, heart, and kidney morphogenesis. FGF-10 is expressed in mesenchymal cells and facilitates epithelial-mesenchymal signaling through binding the epithelially expressed FGF receptor 2b (FGFR2b). FGF-10 also functions as a mitogen for keratinizing epidermal cells, and induces the migration and invasion of cancer cells. |
Bio-activity : | 4MBr-5 cell proliferation, ≤200 ng/mL; ≥5.0 x 10^3 units/mg |
Molecular Mass : | Monomer, 19.3 kDa (170 aa) |
AA Sequence : | MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens (human) ] |
Official Symbol | FGF10 |
Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
Gene ID | 2255 |
mRNA Refseq | NM_004465 |
Protein Refseq | NP_004456 |
MIM | 602115 |
UniProt ID | O15520 |
◆ Recombinant Proteins | ||
FGF10-26205TH | Recombinant Human FGF10 protein | +Inquiry |
Fgf10-561M | Recombinant Mouse Fgf10 protein | +Inquiry |
FGF10-3283H | Recombinant Human FGF10 Protein (Gln38-Ser208), N-His tagged | +Inquiry |
FGF10-1428H | Active Recombinant Human FGF10 protein, His-Avi-tagged, Biotinylated | +Inquiry |
FGF10-421F | Active Recombinant Human FGF10 Protein (169 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket