Active Recombinant Human FCGR2A (R167H) Protein (30-218aa), C-His-tagged

Cat.No. : FCGR2A-17H
Product Overview : Recombinant human Fc gamma RIIA/CD32a (30-218aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability April 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 30-218 aa
Description : Fc gamma RIIA/CD32a, also known as Low affinity immunoglobulin gamma Fc region receptor II-a, are members of the Ig superfamily that function in the activation or inhibition of immune responses. Fc gamma RIIA is expressed on many immune cell types where inhibitory ITIM-bearing receptors may also be co-expressed and coengaged by specific ligands. Signaling through Fc gamma RIIA results in the initiation of inflammatory responses that can be modulated by signals from the inhibitory receptors. The strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors. Besides IC, Fc gamma RII A also binds C-reactive protein (CRP) Two allelic variants of Fc gamma RIIA that differ in their ability to ligate human IgG2 or CRP exist. The R167H allele has been found to have a protective effect against lupus nephritis.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human IgG1 Fc. The ED50 range ≤5 μg/mL.
Molecular Mass : 21.6 kDa (195 aa)
AA Sequence : SADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280 nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens (human) ]
Official Symbol FCGR2A
Synonyms FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032
Gene ID 2212
mRNA Refseq NM_001136219
Protein Refseq NP_001129691
MIM 146790
UniProt ID P12318

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCGR2A Products

Required fields are marked with *

My Review for All FCGR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon