Active Recombinant Human EPGN Protein (73 aa)

• Cat.No.: EPGN-423E
• Product Overview: Recombinant human Epigen (rhEpigen) produced in E. coli is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhEpigen has a molecular mass of 8.1 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 73
• Description: Epigen is a cytokine belonging to the Epidermal Growth Factor (EGF) superfamily, which also includes Epiregulin, Amphiregulin, Neuregulin 2-β, and Transforming Growth Factor α. The precursor of Epigen produced in tissues has 154 amino acids, and shares the characteristics of other members of EGF superfamily, including 3 disulfide bonds formed by 6 cysteines. Epigen is present in testis, heart, and liver, and it binds to EGF receptors with a much lower binding affinity than EGF. However, Epigen is more mitogenic than EGF. Epigen achieves its strong mitogenic potency by suppressing ligand-induced receptor inactivation. Unlike EGF, Epigen can also bind to EGF receptors in low pH conditions, helping its recycling. Therefore Epigen has anomalous potency due to its prolonged presence.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1 × 10^3 units/mg.
• Molecular Mass: 8.1 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Epigen (rhEpigen) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhEpigen remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
• Official Symbol: EPGN
• Synonyms: EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542
• Gene ID: 255324
• mRNA Refseq: NM_001013442
• Protein Refseq: NP_001013460
• MIM: 618717
• UniProt ID: Q6UW88