Active Recombinant Human EPGN Protein
Cat.No. : | EPGN-290E |
Product Overview : | Recombinant Human EPGN Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 μg/mL, measured in a proliferation assay using 3T3 cells. |
Molecular Mass : | 15~20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Epigen remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ] |
Official Symbol | EPGN |
Synonyms | EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542; |
Gene ID | 255324 |
mRNA Refseq | NM_001013442 |
Protein Refseq | NP_001013460 |
MIM | 618717 |
UniProt ID | Q6UW88 |
◆ Recombinant Proteins | ||
EPGN-126E | Active Recombinant Human EPGN Protein (72 aa) | +Inquiry |
EPGN-4313HF | Recombinant Full Length Human EPGN Protein, GST-tagged | +Inquiry |
EPGN-423E | Active Recombinant Human EPGN Protein (73 aa) | +Inquiry |
EPGN-014H | Active Recombinant Human EPGN protein | +Inquiry |
Epgn-2843M | Recombinant Mouse Epgn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPGN-249HCL | Recombinant Human EPGN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPGN Products
Required fields are marked with *
My Review for All EPGN Products
Required fields are marked with *
0
Inquiry Basket