Active Recombinant Human EGF Protein

• Cat.No.: EGF-74H
• Product Overview: Recombinant Human EGF Protein without tag was expressed in E. coli.

Specification

• Description: Epidermal growth factor (EGF) is a growth factor that stimulates the proliferation, differentiation, and survival of epithelial and epidermal cells. EGF contains three intramolecular disulfide bonds and binds in high affinity to the epidermal growth factor receptor (EGFR). EGF is overexpressed in multiple tumor cell lines and promotes resistance to chemotherapy and radiation treatments.
• Source: E. coli
• Species: Human
• Bio-activity: 3T3 cell proliferation, ≤100 pg/mL
• Molecular Mass: Monomer, 6.2 kDa (53 aa)
• AA Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: EGF epidermal growth factor [ Homo sapiens (human) ]
• Official Symbol: EGF
• Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4
• Gene ID: 1950
• mRNA Refseq: NM_001178130
• Protein Refseq: NP_001171601
• MIM: 131530
• UniProt ID: P01133