Active Recombinant Human EGF Protein (53 aa)

• Cat.No.: EGF-429E
• Product Overview: Recombinant human Epidermal Growth Factor (EGF) is a 6,200 Da protein containing 53 amino acid residues.

Specification

• Description: Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50, calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less then 2 ng/mL, corresponding to a specific activity of 5.0 × 10^5 IU/mg.
• Molecular Mass: 6.0 kDa+/-10% determined by reduced SDS-PAGE
• Protein length: 53
• AA Sequence: MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Endotoxin: Less than 0.1 ng/μg (1 EU/μg) of recombinant human Epidermal Growth Factor (EGF) as determined by LAL test.
• Purity: Greater than 95% as determined by (a) Analysis by SEC-HPLC (b) Analysis by reducing and non-reducing SDS-PAGE Silver Stained gel
• Storage: Lyophilized recombinant Human Epidermal Growth Factor (rhEGF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhEGF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
• Storage Buffer: Recombinant human Epidermal Growth Factor (EGF) was lyophilized after extensive dialysis against 10mM Phosphate buffer, pH7.0, 200mM NaCl buffer.
• Reconstitution: It is recommended to reconstitute the lyophilized recombinant human Epidermal Growth Factor (EGF) in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: EGF epidermal growth factor [ Homo sapiens ]
• Official Symbol: EGF
• Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4
• Gene ID: 1950
• mRNA Refseq: NM_001178130
• Protein Refseq: NP_001171601
• MIM: 131530
• UniProt ID: P01133