| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| ProteinLength : |
189 amino acids |
| Description : |
Human Cu/Zn Superoxide Dismutase (SOD) catalyzes the reaction between superoxide anions and hydrogen to yield molecular oxygen and hydrogen peroxide. The enzyme protects the cell against dangerous levels of superoxide. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Fully biologically active when compared to standard. The potency per mg was tested by Pyrogallic Acid method and was found to be more than 10,000 Units/mg. |
| Molecular Mass : |
Approximately 20.0 kDa. a homodimer, non-glycosylated polypeptide chain containing 189 amino acids with 10 x His at the N-terminal. |
| AA Sequence : |
MGHHHHHHHHHHSSGHIEGRHMTYARAAARQARALEATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
| Endotoxin : |
Less than 1 EU/mg of rHuSOD, His as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
