Active Recombinant Human CSF3 Protein

• Cat.No.: CSF3-281C
• Product Overview: Recombinant Human CSF3 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF). In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.1 ng/mL, determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells, corresponding to a specific activity of >1 × 10^7 units/mg.
• Molecular Mass: 18.7kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhG-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
• Official Symbol: CSF3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33, G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33
• Gene ID: 1440
• mRNA Refseq: NM_000759
• Protein Refseq: NP_000750
• MIM: 138970
• UniProt ID: P09919