Active Recombinant Human CSF1 Protein (159 aa)

• Cat.No.: CSF1-335C
• Product Overview: Recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 159 amino acids each. A fully biologically active molecule, rhM-CSF has a molecular mass of 28 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 159
• Description: Macrophage Colony-Stimulating Factor 1 (M-CSF), involved especially in monocytopoiesis, is a hematopoietic growth factor. In mammals, it exits three isoforms, which invariably share an N-terminal 32-aa signal peptide, a 149-residue growth factor domain, a 21-residue transmembrane region and a 37-aa cytoplasmictail. The biological activity of human M-CSF is maintained within the 149-aa growth factor domain, and it is only active in the disulfide-linked dimeric form, which is bonded at Cys63.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 of 1 - 3 ng/mL, measured by cell proliferation assay of M-NFS-60, corresponding to a specific activity of 3.3 5-1 × 10^6 units/mg.
• Molecular Mass: 28 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by non-reducing SDS-PAGE.
• Storage: Lyophilized recombinant human Macrophage Colony-Stimulating Factor 1 (rhM-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhM-CSF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50 mM Tris-HCl, pH 8.0.
• Reconstitution: Reconstituted in ddH2O or PBS or Tris-HCl, pH 8.0 at 100 μg/mL.

Gene Information

• Gene Name: CSF1 colony stimulating factor 1 (macrophage) [ Homo sapiens ]
• Official Symbol: CSF1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; M CSF; MCSF; MGC31930; lanimostim; CSF-1
• Gene ID: 1435
• mRNA Refseq: NM_000757
• Protein Refseq: NP_000748
• MIM: 120420
• UniProt ID: P09603