Active Recombinant Human CLDN4 Full Length Transmembrane protein, His-tagged(VLPs)

Cat.No. : CLDN4-11H
Product Overview : Recombinant Human CLDN4 Full Length protein(O14493)(1-209aa)(VLPs), fused with His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-209aa
Form : Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.
Molecular Mass : 23.4 kDa
AA Sequence : MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLDN4 claudin 4 [ Homo sapiens ]
Official Symbol CLDN4
Synonyms CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R;
Gene ID 1364
mRNA Refseq NM_001305
Protein Refseq NP_001296
MIM 602909
UniProt ID O14493

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLDN4 Products

Required fields are marked with *

My Review for All CLDN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon