Recombinant Human CCL24 Protein, His-tagged
Cat.No. : | CCL24-035H |
Product Overview : | Purified recombinant protein of Human chemokine (C-C motif) ligand 24 (CCL24) was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008]. |
Molecular Mass : | 11.5 kDa |
AA Sequence : | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Gene Name | CCL24 chemokine (C-C motif) ligand 24 [ Homo sapiens ] |
Official Symbol | CCL24 |
Synonyms | CCL24; chemokine (C-C motif) ligand 24; SCYA24, small inducible cytokine subfamily A (Cys Cys), member 24; C-C motif chemokine 24; CK beta 6; Ckb 6; eotaxin 2; MPIF 2; MPIF2; myeloid progenitor inhibitory factor 2; CK-beta-6; eotaxin-2; small-inducible cytokine A24; eosinophil chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 24; Ckb-6; MPIF-2; SCYA24; |
Gene ID | 6369 |
mRNA Refseq | NM_002991 |
Protein Refseq | NP_002982 |
MIM | 602495 |
UniProt ID | O00175 |
◆ Recombinant Proteins | ||
CCL24-0629H | Recombinant Human CCL24 Protein, GST-Tagged | +Inquiry |
CCL24-816H | Recombinant Human CCL24 protein, His-tagged | +Inquiry |
Ccl24-5633M | Recombinant Mouse Ccl24 protein, hFc-tagged | +Inquiry |
Ccl24-475M | Recombinant Mouse Ccl24 protein | +Inquiry |
CCL24-687R | Recombinant Rhesus monkey CCL24 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL24-437HCL | Recombinant Human CCL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL24 Products
Required fields are marked with *
My Review for All CCL24 Products
Required fields are marked with *
0
Inquiry Basket