Active Recombinant Human CCL20 Protein (70 aa)

• Cat.No.: CCL20-327C
• Product Overview: Recombinant Human MIP-3α/CCL20 produced in E. coliis a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3α/CCL20has a molecular mass of 8.0 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 70
• Description: Chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3A) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus. It can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of humanMIP-3 alpha/CCL20 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR6 cells (human Gα15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/mL.
• Molecular Mass: 8.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human MIP- 3α/CCL20 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human MIP-3α/CCL20 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 53mM Na2HPO4, 147 mM NaH2PO4, 300 mM NaCl, pH6.5.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ]
• Official Symbol: CCL20
• Synonyms: CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20
• Gene ID: 6364
• mRNA Refseq: NM_001130046
• Protein Refseq: NP_001123518
• MIM: 601960
• UniProt ID: P78556