Active Recombinant Human CCL13 Protein (75 aa)
Cat.No. : | CCL13-078C |
Product Overview : | Recombinant Human CCL13 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 75 |
Description : | CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
Molecular Mass : | 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids. |
AA Sequence : | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Endotoxin : | Less than 1 EU/mg of rHuMCP-4/CCL13 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL13 chemokine (C-C motif) ligand 13 [ Homo sapiens ] |
Official Symbol | CCL13 |
Synonyms | CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13; |
Gene ID | 6357 |
mRNA Refseq | NM_005408 |
Protein Refseq | NP_005399 |
MIM | 601391 |
UniProt ID | Q99616 |
◆ Recombinant Proteins | ||
CCL13-432H | Recombinant Human CCL13 protein, His-tagged | +Inquiry |
CCL13-078C | Active Recombinant Human CCL13 Protein (75 aa) | +Inquiry |
CCL13-288H | Recombinant Human CCL13 protein | +Inquiry |
CCL13-84H | Recombinant Human CCL13 Protein, Biotin-tagged | +Inquiry |
CCL13-151H | Recombinant Human CCL13 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL13-7734HCL | Recombinant Human CCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL13 Products
Required fields are marked with *
My Review for All CCL13 Products
Required fields are marked with *
0
Inquiry Basket