Recombinant Full Length Human CCL13 Protein, GST-tagged

Cat.No. : CCL13-2920HF
Product Overview : Human CCL13 full-length ORF (AAH08621, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 98 amino acids
Description : This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014]
Molecular Mass : 36.52 kDa
AA Sequence : MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL13 chemokine (C-C motif) ligand 13 [ Homo sapiens ]
Official Symbol CCL13
Synonyms CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13;
Gene ID 6357
mRNA Refseq NM_005408
Protein Refseq NP_005399
MIM 601391
UniProt ID Q99616

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL13 Products

Required fields are marked with *

My Review for All CCL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon