Recombinant Human CCL13 protein
Cat.No. : | CCL13-288H |
Product Overview : | Recombinant Human CCL13 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 75 |
Description : | Human CCL13 is belonging to the CC chemokine family and is encoded by the gene CCL13 in humans. CCL13 (MCP-4) shares 56-61 % sequence identity with MCP-1 (CCL2) and MCP-3 (CCL7) and is 60 % identical to Eotaxin (CCL11). CCL13 was a potent chemoattractant for monocytes and eosinophils and stimulated histamine release from basophils. CCL13 can induce a calcium flux in HEK-293 cells transfected with the receptor CCR2B and CCR3. That shows the function receptors of CCL3 are CCR2B and CCR3. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml. |
Molecular Mass : | Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids. |
AA Sequence : | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Endotoxin : | Less than 1 EU/μg of rHuMCP-4/CCL13 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL13 |
Official Symbol | CCL13 |
Synonyms | CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13; |
Gene ID | 6357 |
mRNA Refseq | NM_005408 |
Protein Refseq | NP_005399 |
MIM | 601391 |
UniProt ID | Q99616 |
◆ Recombinant Proteins | ||
CCL13-151H | Recombinant Human CCL13 Protein, DYKDDDDK-tagged | +Inquiry |
CCL13-09H | Recombinant Human CCL13 Protein | +Inquiry |
CCL13-73H | Recombinant Human CCL13 Protein | +Inquiry |
CCL13-221H | Recombinant Human CCL13 Protein, His/GST-tagged | +Inquiry |
CCL13-1308H | Recombinant Human CCL13 Protein (Gln24-Thr98), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL13-7734HCL | Recombinant Human CCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL13 Products
Required fields are marked with *
My Review for All CCL13 Products
Required fields are marked with *
0
Inquiry Basket