Recombinant Human CCL13 protein

• Cat.No.: CCL13-288H
• Product Overview: Recombinant Human CCL13 protein was expressed in Escherichia coli.

Specification

• Description: Human CCL13 is belonging to the CC chemokine family and is encoded by the gene CCL13 in humans. CCL13 (MCP-4) shares 56-61 % sequence identity with MCP-1 (CCL2) and MCP-3 (CCL7) and is 60 % identical to Eotaxin (CCL11). CCL13 was a potent chemoattractant for monocytes and eosinophils and stimulated histamine release from basophils. CCL13 can induce a calcium flux in HEK-293 cells transfected with the receptor CCR2B and CCR3. That shows the function receptors of CCL3 are CCR2B and CCR3.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml.
• Molecular Mass: Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
• Protein length: 75
• AA Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
• Endotoxin: Less than 1 EU/μg of rHuMCP-4/CCL13 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: CCL13
• Official Symbol: CCL13
• Synonyms: CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13
• Gene ID: 6357
• mRNA Refseq: NM_005408
• Protein Refseq: NP_005399
• MIM: 601391
• UniProt ID: Q99616