Active Recombinant Human Calprotectin S100A9 Protein

Cat.No. : S100A9-1019H
Product Overview : Recombinant Human S100 calcium binding protein A9 antigen is produced by E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Predicted molecular weight: 13 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 2-114 a.a.
Antigen Description : Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment.
Description : Calprotectin belongs to the family of S100 proteins and is composed of two subunits S100A8 and S100A9. Increased plasma concentrations are found in response to infections and inflammation. Faecal calprotectin measurement is used for detection of gastrointestinal inflammation or neoplasia and for assessment of inflammatory bowel disease activity and response to treatment.
Form : Lyophilized
Bio-activity : Anti-h Calprotectin 3403: + Anti-h Calprotectin 3404: - Anti-h Calprotectin 3405: - Anti-h Calprotectin 3406: - Anti-h Calprotectin 3407: -
Molecular Mass : 13kDa
AA Sequence : TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDL DTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Purity : >90% by SDS-PAGE
Storage : -20centigrade
Concentration : 0.5 mg/ml when reconstituted with 1000 µl of deionized water
Storage Buffer : PBS, pH 7.4
Reconstitution : Reconstitute lyophilized protein with 1000 µl of deionized water
Gene Name S100A9 S100 calcium binding protein A9 [ Homo sapiens ]
Official Symbol S100A9
Synonyms S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG;
Gene ID 6280
mRNA Refseq NM_002965
Protein Refseq NP_002956
MIM 123886
UniProt ID P06702

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A9 Products

Required fields are marked with *

My Review for All S100A9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon