Active Recombinant Human CADM4, Fc-tagged, Biotinylated

Cat.No. : CADM4-650H
Product Overview : The recombinant human NECL4-Fc fusion protein is expressed as a 532-amino acid protein consisting of Pro21 - Ala324 region of NECL4 (UniProt accession #Q8NFZ8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 21-324 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized NECL4 interact heterophilically with NECL1 and NECL3. Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons.
Molecular Mass : Calculated molecular mass (kDa): 59.0; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
AA Sequence : PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDA RLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGV SSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLV LTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVE AQTSVPYASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name CADM4 cell adhesion molecule 4 [ Homo sapiens ]
Official Symbol CADM4
Synonyms CADM4; cell adhesion molecule 4; IGSF4C, immunoglobulin superfamily, member 4C; Necl 4; nectin like 4; SynCAM4; TSLL2; TSLC1-like 2; nectin-like 4; TSLC1-like protein 2; nectin-like protein 4; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; NECL4; IGSF4C; Necl-4; synCAM4;
Gene ID 199731
mRNA Refseq NM_145296
Protein Refseq NP_660339
MIM 609744
UniProt ID Q8NFZ8
Chromosome Location 19q13.32

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CADM4 Products

Required fields are marked with *

My Review for All CADM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon