Active Recombinant Human BTC Protein (80 aa)

• Cat.No.: BTC-135B
• Product Overview: Recombinant Human BTC Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 80
• Description: Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-a, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin and the Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2 × 10^7units/mg.
• Molecular Mass: Recombinant human Betacellulin is a 9.0 kDa monomeric protein, containing 80 amino residues, which comprises the mature EGF homologous portion of the Betacellulin protein.
• AA Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
• Endotoxin: Less than 1 EU/μg of rHuBetacellulin as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: BTC betacellulin [ Homo sapiens ]
• Official Symbol: BTC
• Synonyms: BTC; betacellulin; probetacellulin
• Gene ID: 685
• mRNA Refseq: NM_001729
• Protein Refseq: NP_001720
• MIM: 600345
• UniProt ID: P35070