Active Recombinant Human ATP1B1 Protein (63-303aa), C-His tagged

Cat.No. : ATP1B1-17H
Product Overview : Recombinant human ATP1B1 protein (63-303aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 63-303aa
Description : The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known.
Form : Liquid
Bio-activity : > 3,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25 centigrade.
Molecular Mass : 29 kDa (250aa)
AA Sequence : EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name ATP1B1 ATPase Na+/K+ transporting subunit beta 1 [ Homo sapiens (human) ]
Official Symbol ATP1B1
Synonyms ATP1B1; ATPase Na+/K+ transporting subunit beta 1; ATP1B; sodium/potassium-transporting ATPase subunit beta-1; ATPase, Na+/K+ transporting, beta 1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; Na, K-ATPase beta-1 polypeptide; adenosinetriphosphatase; sodium pump subunit beta-1; sodium-potassium ATPase subunit beta 1 (non-catalytic); sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; EC 3.6.1.3
Gene ID 481
mRNA Refseq NM_001677
Protein Refseq NP_001668
MIM 182330
UniProt ID P05026

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP1B1 Products

Required fields are marked with *

My Review for All ATP1B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon