Active Recombinant Human ADIPOQ Protein

• Cat.No.: ADIPOQ-06H
• Product Overview: Recombinant human gAcrp30/Adipolean (rhgAcrp30) produced in E. coli is a single non-glycosylated polypeptide chain containing 144 amino acids. A fully biologically active molecule, rhgAcrp30 has a molecular mass of 16.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 144 amino acids
• Description: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 μg/mL, measured by a cell growth inhibition assay using M1 cells, corresponding to a specific activity of > 100 units/mg.
• Molecular Mass: 16.6 kDa, observed by reducing SDS-PAGE.
• AA Sequence: KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Usage: This material is offered for research, laboratory or further evaluation purposes. For research use only.
• Storage: Lyophilized recombinant human gAcrp30/Adipolean (rhgAcrp30) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhgAcrp30 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ]
• Official Symbol: ADIPOQ
• Synonyms: Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
• Gene ID: 9370
• mRNA Refseq: NM_004797
• Protein Refseq: NP_004788
• MIM: 605441
• UniProt ID: Q15848