Active Recombinant Human ACVR1C, Fc-tagged

Cat.No. : ACVR1C-531H
Product Overview : The recombinant human ACVR1C/ALK7-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu22 - Glu113 region of ACVR1C (UniProt accession #Q8NER5) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 22-113 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized ACVR1C binds human Nodal in a functional ELISA. Blocks Nodal-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 35.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNI TLHLPTASPNAPKLGPMESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition.
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name ACVR1C activin A receptor, type IC [ Homo sapiens ]
Official Symbol ACVR1C
Synonyms ACVR1C; activin A receptor, type IC; activin receptor type-1C; ACVRLK7; ALK7; ALK-7; ACTR-IC; activin receptor type IC; activin receptor-like kinase 7;
Gene ID 130399
mRNA Refseq NM_001111031
Protein Refseq NP_001104501
MIM 608981
UniProt ID Q8NER5
Chromosome Location 2q24.2
Pathway Developmental Biology, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function ATP binding; activin receptor activity, type I; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACVR1C Products

Required fields are marked with *

My Review for All ACVR1C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon