Active Recombinant Full Length Human UMPS Protein, C-Flag-tagged
Cat.No. : | UMPS-339HFL |
Product Overview : | Recombinant Full Length Human UMPS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | UMPS activity is verified in a bioassay |
Molecular Mass : | 52 kDa |
AA Sequence : | MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Full Length : | Full L. |
Gene Name | UMPS uridine monophosphate synthetase [ Homo sapiens (human) ] |
Official Symbol | UMPS |
Synonyms | OPRT |
Gene ID | 7372 |
mRNA Refseq | NM_000373.4 |
Protein Refseq | NP_000364.1 |
MIM | 613891 |
UniProt ID | P11172 |
◆ Recombinant Proteins | ||
UMPS-3595H | Recombinant Human UMPS protein, His-tagged | +Inquiry |
UMPS-301620H | Recombinant Human UMPS protein, GST-tagged | +Inquiry |
UMPS-212H | Recombinant Human UMPS Protein, His-tagged | +Inquiry |
UMPS-349H | Recombinant Human uridine monophosphate synthetase, His-tagged | +Inquiry |
Umps-7928M | Recombinant Mouse Umps protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UMPS Products
Required fields are marked with *
My Review for All UMPS Products
Required fields are marked with *
0
Inquiry Basket