Recombinant Human UMPS protein, GST-tagged

• Cat.No.: UMPS-301620H
• Product Overview: Recombinant Human UMPS (189-480 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Val189-Val480
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: UMPS uridine monophosphate synthetase [ Homo sapiens ]
• Official Symbol: UMPS
• Synonyms: UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT
• Gene ID: 7372
• mRNA Refseq: NM_000373
• Protein Refseq: NP_000364
• MIM: 613891
• UniProt ID: P11172