Active Recombinant Full Length Human SLC6A4 Protein, C-Flag-tagged
Cat.No. : | SLC6A4-601HFL |
Product Overview : | Recombinant Full Length Human SLC6A4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake. There have been conflicting results in the literature about the possible effect, if any, that this polymorphism may play in behavior and depression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB standard |
Molecular Mass : | 70.1 kDa |
AA Sequence : | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTL VAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALG QYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCT NYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKV VWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASY NKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVK LLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSP PQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | SLC6A4 solute carrier family 6 member 4 [ Homo sapiens (human) ] |
Official Symbol | SLC6A4 |
Synonyms | HTT; 5HTT; OCD1; SERT; 5-HTT; SERT1; hSERT; 5-HTTLPR |
Gene ID | 6532 |
mRNA Refseq | NM_001045.6 |
Protein Refseq | NP_001036.1 |
MIM | 182138 |
UniProt ID | P31645 |
◆ Recombinant Proteins | ||
SLC6A4-1099H | Recombinant Human SLC6A4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC6A4-2322H | Recombinant Human SLC6A4 protein, GST-tagged | +Inquiry |
Slc6a4-2079M | Recombinant Mouse Slc6a4 Protein, His-tagged | +Inquiry |
SLC6A4-2034H | Recombinant Human SLC6A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC6A4-6307H | Recombinant Human SLC6A4 Protein (Ala181-Ser252), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC6A4-1638HCL | Recombinant Human SLC6A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC6A4 Products
Required fields are marked with *
My Review for All SLC6A4 Products
Required fields are marked with *
0
Inquiry Basket