Recombinant Human SLC6A4 protein, GST-tagged

Description :	This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	96.7 kDa
AA Sequence :	METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Protein length :	1-630 a.a.

Gene Name	SLC6A4 solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 [ Homo sapiens ]
Official Symbol	SLC6A4
Synonyms	SLC6A4; solute carrier family 6 (neurotransmitter transporter, serotonin), member 4; HTT; sodium-dependent serotonin transporter; 5 HTT; SERT1; 5HT transporter; 5-hydroxytryptamine transporter; solute carrier family 6 member 4; Na+/Cl- dependent serotonin transporter; 5HTT; OCD1; SERT; 5-HTT; hSERT; 5-HTTLPR;
Gene ID	6532
mRNA Refseq	NM_001045
Protein Refseq	NP_001036
MIM	182138
UniProt ID	P31645
Chromosome Location	17q11.2
Pathway	Monoamine Transport, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; Serotonergic synapse, organism-specific biosystem;
Function	Rab GTPase binding; actin filament binding; cocaine binding; monoamine transmembrane transporter activity; myosin binding; nitric-oxide synthase binding; protein binding; protein homodimerization activity; serotonin transmembrane transporter activity; serotonin transmembrane transporter activity; serotonin:sodium symporter activity; serotonin:sodium symporter activity; symporter activity; syntaxin-1 binding;