Active Recombinant Full Length Human SERPINB2 Protein, C-Flag-tagged
Cat.No. : | SERPINB2-345HFL |
Product Overview : | Recombinant Full Length Human SERPINB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vivo treatment (intracerebral) |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SERPINB2 serpin family B member 2 [ Homo sapiens (human) ] |
Official Symbol | SERPINB2 |
Synonyms | PAI; PAI2; PAI-2; PLANH2; HsT1201 |
Gene ID | 5055 |
mRNA Refseq | NM_002575.3 |
Protein Refseq | NP_002566.1 |
MIM | 173390 |
UniProt ID | P05120 |
◆ Recombinant Proteins | ||
SERPINB2-624H | Recombinant Human serpin peptidase inhibitor, clade B (ovalbumin), member 2, His-tagged | +Inquiry |
SERPINB2-2592H | Recombinant Human SERPINB2, GST-tagged | +Inquiry |
SERPINB2-6485H | Recombinant Human SERPINB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINB2-345HFL | Active Recombinant Full Length Human SERPINB2 Protein, C-Flag-tagged | +Inquiry |
SERPINB2-14937M | Recombinant Mouse SERPINB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB2-652HCL | Recombinant Human SERPINB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB2 Products
Required fields are marked with *
My Review for All SERPINB2 Products
Required fields are marked with *
0
Inquiry Basket