Active Recombinant Full Length Human PPM1G Protein, C-Flag-tagged
Cat.No. : | PPM1G-560HFL |
Product Overview : | Recombinant Full Length Human PPM1G Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro phosphatase assay |
Molecular Mass : | 59.1 kDa |
AA Sequence : | MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase |
Full Length : | Full L. |
Gene Name | PPM1G protein phosphatase, Mg2+/Mn2+ dependent 1G [ Homo sapiens (human) ] |
Official Symbol | PPM1G |
Synonyms | PP2CG; PPP2CG; PP2CGAMMA |
Gene ID | 5496 |
mRNA Refseq | NM_177983.3 |
Protein Refseq | NP_817092.1 |
MIM | 605119 |
UniProt ID | O15355 |
◆ Recombinant Proteins | ||
PPM1G-5956H | Recombinant Human PPM1G Protein (Met317-Asp546), C-His tagged | +Inquiry |
PPM1G-5767H | Recombinant Human PPM1G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPM1G-46H | Recombinant Human PPM1G, His-tagged | +Inquiry |
PPM1G-1352H | Recombinant Human PPM1G Protein, Flag-tagged | +Inquiry |
PPM1G-805C | Recombinant Cynomolgus PPM1G Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPM1G-2960HCL | Recombinant Human PPM1G 293 Cell Lysate | +Inquiry |
PPM1G-2959HCL | Recombinant Human PPM1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPM1G Products
Required fields are marked with *
My Review for All PPM1G Products
Required fields are marked with *
0
Inquiry Basket