Active Recombinant Full Length Human POLR2M Protein, C-Flag-tagged
Cat.No. : | POLR2M-511HFL |
Product Overview : | Recombinant Full Length Human POLR2M Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a subunit of a specific form of RNA polymerase II termed Pol II(G). The encoded protein may act as a negative regulator of transcriptional activation by the Mediator complex. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 4. Readthrough transcription between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein) is represented with GeneID 145781. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | WB positive control |
Molecular Mass : | 41.6 kDa |
AA Sequence : | MCSLPRGFEPQAPEDLAQRSLVELREMLKRQERLLRNEKFICKLPDKGKKIFDSFAKLKAAIAECEEVRR KSELFNPVSLDCKLRQKAIAEVDVGTDKAQNSDPILDTSSLVPGCSSVDNIKSSQTSQNQGLGRPTLEGD EETSEVEYTVNKGPASSNRDRVPPSSEASEHHPRHRVSSQAEDTSSSFDNLFIDRLQRITIADQGEQQSE ENASTKNLTGLSSGTEKKPHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQKSGSPISSEERRRR DKQHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESS GRYREVRDEDDDWSSDEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Ion Channels: Other |
Full Length : | Full L. |
Gene Name | POLR2M RNA polymerase II subunit M [ Homo sapiens (human) ] |
Official Symbol | POLR2M |
Synonyms | GCOM1; Gdown; Gdown1; GRINL1A |
Gene ID | 81488 |
mRNA Refseq | NM_015532.5 |
Protein Refseq | NP_056347.1 |
MIM | 606485 |
UniProt ID | Q6EEV4 |
◆ Recombinant Proteins | ||
POLR2M-1731H | Recombinant Human POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR2M-28539TH | Recombinant Human POLR2M, His-tagged | +Inquiry |
POLR2M-5348H | Recombinant Human POLR2M Protein, GST-tagged | +Inquiry |
POLR2M-4572R | Recombinant Rat POLR2M Protein | +Inquiry |
Polr2m-5003M | Recombinant Mouse Polr2m Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2M-5742HCL | Recombinant Human GRINL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POLR2M Products
Required fields are marked with *
My Review for All POLR2M Products
Required fields are marked with *
0
Inquiry Basket