Active Recombinant Full Length Human PLAUR Protein, C-Flag-tagged
Cat.No. : | PLAUR-338HFL |
Product Overview : | Recombinant Full Length Human PLAUR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Dimerization assay (confocal) |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Complement and coagulation cascades |
Full Length : | Full L. |
Gene Name | PLAUR plasminogen activator, urokinase receptor [ Homo sapiens (human) ] |
Official Symbol | PLAUR |
Synonyms | CD87; UPAR; URKR; U-PAR |
Gene ID | 5329 |
mRNA Refseq | NM_002659.4 |
Protein Refseq | NP_002650.1 |
MIM | 173391 |
UniProt ID | Q03405 |
◆ Recombinant Proteins | ||
PLAUR-338HFL | Active Recombinant Full Length Human PLAUR Protein, C-Flag-tagged | +Inquiry |
PLAUR-0811H | Active Recombinant Human PLAUR protein, Fc-tagged | +Inquiry |
PLAUR-726R | Recombinant Rat PLAUR Protein (25-299 aa), His-tagged | +Inquiry |
Plaur-586M | Recombinant Mouse Plaur protein, His-tagged | +Inquiry |
Plaur-831M | Active Recombinant Mouse Plaur protein, His&hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAUR-1888HCL | Recombinant Human PLAUR cell lysate | +Inquiry |
PLAUR-2551MCL | Recombinant Mouse PLAUR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLAUR Products
Required fields are marked with *
My Review for All PLAUR Products
Required fields are marked with *
0
Inquiry Basket