Active Recombinant Full Length Human ELK1 Protein (M1-P428), N-GST/6×His tagged

• Cat.No.: ELK1-6923H
• Product Overview: Human ELK1, full length, amino acids (M1-P428, as in NCBI/Protein entry NP_005220.2), N-GST/6×His fusion protein with a 3C cleavage site, expressed in Sf9 cells.

Specification

• Species: Human
• Source: Sf9 Cells
• Tag: GST&His
• Protein Length: M1-P428
• Description: This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14.
• Molecular Mass: 73163 Da
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRDSLEVLFQGPLAMDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
• Applications: ELK1 has been validated for use as substrate in radiometric in-vitro kinase activity assays.
• Storage: At -80 centigrade
  For complete recovery, mix well and spin before use. Product must not be stored in diluted solutions, aliquots below 10μl are not advisable. Avoid repeated freeze-thaw cycles!
• Concentration: 0.303 μg/μL (Bradford method using BSA as standard protein)
• Storage Buffer: 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM DTT, 15 mM reduced glutathione, 20 % glycerol

Gene Information

• Gene Name: ELK1 ETS transcription factor ELK1 [ Homo sapiens (human) ]
• Official Symbol: ELK1
• Synonyms: ELK1; ETS transcription factor ELK1; ETS domain-containing protein Elk-1; ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS-like gene 1; tyrosine kinase (ELK1) oncogene
• Gene ID: 2002
• mRNA Refseq: NM_005229.4
• Protein Refseq: NP_005220.2
• MIM: 311040
• UniProt ID: P19419