Active Recombinant Full Length Human DNMT3B Protein, C-Flag-tagged
Cat.No. : | DNMT3B-334HFL |
Product Overview : | Recombinant Full Length Human DNMT3B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. |
Form : | 10mM NaCl, 20 mM Phosphate buffer, pH7.6. |
Bio-activity : | Surface Plasmon Ressonance (SPR) |
Molecular Mass : | 95.6 kDa |
AA Sequence : | MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDL TGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEF PATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSG DGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVAL GLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKP NNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQM ASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLC SNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRN ITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVV AMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKK VQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIR HLFAPLKDYFACETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency |
Protein Pathways : | Cysteine and methionine metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | DNMT3B DNA methyltransferase 3 beta [ Homo sapiens (human) ] |
Official Symbol | DNMT3B |
Synonyms | ICF; ICF1; FSHD4; M.HsaIIIB |
Gene ID | 1789 |
mRNA Refseq | NM_006892.4 |
Protein Refseq | NP_008823.1 |
MIM | 602900 |
UniProt ID | Q9UBC3 |
◆ Recombinant Proteins | ||
DNMT3B-895H | Recombinant Human DNMT3B Protein, His-tagged | +Inquiry |
Dnmt3b-1646M | Recombinant Mouse Dnmt3b protein, His & T7-tagged | +Inquiry |
Dnmt3b-2622M | Recombinant Mouse Dnmt3b Protein, Myc/DDK-tagged | +Inquiry |
DNMT3B-334HFL | Active Recombinant Full Length Human DNMT3B Protein, C-Flag-tagged | +Inquiry |
DNMT3B-2792H | Recombinant Human DNMT3B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNMT3B Products
Required fields are marked with *
My Review for All DNMT3B Products
Required fields are marked with *
0
Inquiry Basket