Active Recombinant Full Length Human DAXX Protein, C-Flag-tagged
Cat.No. : | DAXX-335HFL |
Product Overview : | Recombinant Full Length Human DAXX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Pull-down assay |
Molecular Mass : | 81.2 kDa |
AA Sequence : | MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | DAXX death domain associated protein [ Homo sapiens (human) ] |
Official Symbol | DAXX |
Synonyms | DAP6; EAP1; BING2; SMIM40 |
Gene ID | 1616 |
mRNA Refseq | NM_001141969.2 |
Protein Refseq | NP_001135441.1 |
MIM | 603186 |
UniProt ID | Q9UER7 |
◆ Recombinant Proteins | ||
DAXX-11834H | Recombinant Human DAXX, GST-tagged | +Inquiry |
DAXX-4311M | Recombinant Mouse DAXX Protein | +Inquiry |
DAXX-4829H | Recombinant Human DAXX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DAXX-1182H | Recombinant Human DAXX Protein (1-233 aa), GST-tagged | +Inquiry |
DAXX-335HFL | Active Recombinant Full Length Human DAXX Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAXX-7071HCL | Recombinant Human DAXX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAXX Products
Required fields are marked with *
My Review for All DAXX Products
Required fields are marked with *
0
Inquiry Basket