Active Recombinant Full Length Human CAMK2A Protein, C-Flag-tagged
Cat.No. : | CAMK2A-508HFL |
Product Overview : | Recombinant Full Length Human CAMK2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity regulator |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIE DEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | CAMK2A calcium/calmodulin dependent protein kinase II alpha [ Homo sapiens (human) ] |
Official Symbol | CAMK2A |
Synonyms | CAMKA; MRD53; MRT63; CaMKIIalpha; CaMKIINalpha |
Gene ID | 815 |
mRNA Refseq | NM_015981.4 |
Protein Refseq | NP_057065.2 |
MIM | 114078 |
UniProt ID | Q8IWE0 |
◆ Recombinant Proteins | ||
CAMK2A-1101R | Recombinant Rat CAMK2A Protein | +Inquiry |
CAMK2A-765R | Recombinant Rat CAMK2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMK2A-6286H | Recombinant Human CAMK2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAMK2A-0178H | Recombinant Human CAMK2A Protein (A2-H478), GST tagged | +Inquiry |
CAMK2A-490H | Recombinant Human CAMK2A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMK2A Products
Required fields are marked with *
My Review for All CAMK2A Products
Required fields are marked with *
0
Inquiry Basket