Active Recombinant Full Length Human APOE Protein, C-Flag-tagged

• Cat.No.: APOE-238HFL
• Product Overview: Recombinant Full Length Human APOE Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Bio-activity: Binding assay
• Molecular Mass: 34.2 kDa
• AA Sequence: MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELL SSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEV QAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRA ATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLK
  SWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Adult stem cells, Druggable Genome, Secreted Protein, Stem cell - Pluripotency
• Protein Pathways: Alzheimer's disease
• Full Length: Full L.

Gene Information

• Gene Name: APOE apolipoprotein E [ Homo sapiens (human) ]
• Official Symbol: APOE
• Synonyms: AD2; LPG; APO-E; ApoE4; LDLCQ5
• Gene ID: 348
• mRNA Refseq: NM_000041.4
• Protein Refseq: NP_000032.1
• MIM: 107741
• UniProt ID: P02649